PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G1295
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 246aa    MW: 28817.5 Da    PI: 4.7186
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G1295genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-14956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+ +Ed++l+ +++++G  +W+  ++  g+ R++k+c++rw +yl
      Gh_D13G1295  9 KGTWSHDEDQKLIAYIRKYGIWNWNEMPKFAGLQRSGKSCRLRWMNYL 56
                     799*****************99************************97 PP

2Myb_DNA-binding49.11.3e-1562105146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eE+e ++++ k lG++ W++Ia++++  Rt++++k++w++
      Gh_D13G1295  62 RGNFSREEEETIIHLQKTLGNR-WSAIAARLP-QRTDNDLKNYWNT 105
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.757456IPR017930Myb domain
SuperFamilySSF466891.01E-277103IPR009057Homeodomain-like
SMARTSM007174.7E-11858IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-211063IPR009057Homeodomain-like
CDDcd001672.48E-91156No hitNo description
PfamPF139211.2E-131271No hitNo description
PROSITE profilePS5129423.57757111IPR017930Myb domain
SMARTSM007174.2E-1461109IPR001005SANT/Myb domain
CDDcd001671.44E-964107No hitNo description
Gene3DG3DSA:1.10.10.606.6E-2464110IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MVRQPYLKKG TWSHDEDQKL IAYIRKYGIW NWNEMPKFAG LQRSGKSCRL RWMNYLRPNI  60
RRGNFSREEE ETIIHLQKTL GNRWSAIAAR LPQRTDNDLK NYWNTRLKKR VMGEKKNPSS  120
ATTETKSSME ENSFDADSSM MVDILLDYQI PTMDDFPELA ADTTISLSDC DLSVAVDDHY  180
NMAMDNNLVS SENYWEIENL WGQSLTMEGL DCEVMSPNSQ LWLHEPIYAC DSYYDPVVEL  240
WVNPFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-2751113108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5895711e-63JX589571.1 Gossypium hirsutum clone NBRI_GE24298 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461887.10.0PREDICTED: transcription factor MYB23-like
TrEMBLA0A0D2U1B70.0A0A0D2U1B7_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17382411
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-49MYB-like 102